null Skip to main content
Sign in

Cagrilintide 5mg

Cagrilintide 5mg, Limitless Biotech
$106.99 - $115.99

✓ Third-party tested by certified labs

✓ Published certificates of analysis

✓ 99% purity standard

Adding to cart… The item has been added

Cagrilintide is a synthetic long-acting amylin analog targeting AMYR/CTR receptors. Lyophilized peptide for research use only.

Product Description

Cagrilintide is a synthetic long-acting amylin analogue designed for in vitro research applications. This modified protein targets both amylin and calcitonin receptors through its specialized amino acid sequence and N-terminal lipidation.

The peptide demonstrates improved stability compared to native amylin while maintaining receptor binding affinity. Supplied as research-grade lyophilized powder with pharmaceutical manufacturing standards.

Third-party tested for purity verification. Intended for qualified research institutions conducting receptor studies and peptide mechanism research. Research use only.

Peptide Specifications

SPECIFICATION DESCRIPTION
Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula C194H312N54O59S2
Molecular Weight 4409.01 g/mol
CAS Number 1415456-99-3
PubChem SID 171397054
Synonyms AM833, AT42613
Purity ≥98.5% (HPLC)
Solubility Soluble in water and aqueous buffers
Storage Conditions Store at -20°C, tightly sealed, away from heat and moisture
Physical Appearance White lyophilized powder
Shelf Life 36 months from date of manufacture when stored properly
Quality Verification Third-party tested by certified laboratory
Manufacturing Standard USA-made, pharmaceutical-grade, GMP compliant
Intended Application In vitro research applications only

Our Product Quality Guarantee

Every Limitless Biotech compound undergoes independent testing for endotoxins and sterility, meeting rigorous research standards through our systematic quality protocols and proactive manufacturing processes.

Buy Cagrilintide From Limitless Biotech

Limitless Biotech provides USA-manufactured Cagrilintide for sale with verified molecular sequences and purity through comprehensive third-party testing. We ensure research quality with same-day shipping and dedicated customer support for your scientific endeavors.

Recently Viewed

loading

 

 
loading

 

 
loading

 

 
loading