Product Description
Cagrilintide is a synthetic long-acting amylin analogue designed for in vitro research applications. This modified protein targets both amylin and calcitonin receptors through its specialized amino acid sequence and N-terminal lipidation.
The peptide demonstrates improved stability compared to native amylin while maintaining receptor binding affinity. Supplied as research-grade lyophilized powder with pharmaceutical manufacturing standards.
Third-party tested for purity verification. Intended for qualified research institutions conducting receptor studies and peptide mechanism research. Research use only.
Peptide Specifications
| SPECIFICATION | DESCRIPTION |
|---|---|
| Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409.01 g/mol |
| CAS Number | 1415456-99-3 |
| PubChem SID | 171397054 |
| Synonyms | AM833, AT42613 |
| Purity | ≥99% (HPLC) |
| Solubility | Soluble in water and aqueous buffers |
| Storage Conditions | Store at -20°C, tightly sealed, away from heat and moisture |
| Physical Appearance | White lyophilized powder |
| Shelf Life | 36 months from date of manufacture when stored properly |
| Quality Verification | Third-party tested by certified laboratory |
| Manufacturing Standard | USA-made, pharmaceutical-grade, GMP compliant |
| Intended Application | In vitro research applications only |
Our Product Quality Guarantee
Every Limitless Biotech compound undergoes independent testing for endotoxins and sterility, meeting rigorous research standards through our systematic quality protocols and proactive manufacturing processes.
Buy Cagrilintide From Limitless Biotech
Limitless Biotech provides USA-manufactured Cagrilintide for sale with verified molecular sequences and purity through comprehensive third-party testing. We ensure research quality with same-day shipping and dedicated customer support for your scientific endeavors.
- Short Description:
- Cagrilintide is a synthetic long-acting amylin analog targeting AMYR/CTR receptors. Lyophilized peptide for research use only.
Contains 500mcg - 1mg of trelahose per 5mg vial of cagrilintide to assist with solubility.
Container:- Glass Vial
- Presentation:
- Solid Crystals
